PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.17G047300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family Dof
Protein Properties Length: 392aa    MW: 43444.1 Da    PI: 8.9237
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.17G047300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.61.5e-3996156262
               zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                          +++alkcprCds+ntkfCyynnyslsqPr+fCkaC+ryWt+GG+lrnvPvGgg+rknk+++
  Manes.17G047300.1.p  96 PQQALKCPRCDSSNTKFCYYNNYSLSQPRHFCKACKRYWTRGGTLRNVPVGGGCRKNKRVK 156
                          7899******************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027011.1E-3398154IPR003851Zinc finger, Dof-type
ProDomPD0074783.0E-2899154IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.525100154IPR003851Zinc finger, Dof-type
PROSITE patternPS013610102138IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 392 aa     Download sequence    Send to blast
MLILLYHNLP KFLLSTPSKR EAHVATCSLS VYSLFRRIPL WEEMLGNCEK MVVISPTTNE  60
WPQNQIDEKS LMPSTSKLME KRGQELSQPQ HQQQQPQQAL KCPRCDSSNT KFCYYNNYSL  120
SQPRHFCKAC KRYWTRGGTL RNVPVGGGCR KNKRVKRPNP AVEGATSVSG ANPNLPSQTQ  180
IDISSTSNHI NPLFYGLPTN PSEMNLPFTG RFNSRVSSSV DTVSVSGYDL QPQLNALALG  240
FSSGIMSNEA NGFNPAKQIQ DVVTSSSLLS RSIFGSSSST MTSPTMATLL ASNLHQQKFD  300
IKDFRAPNHF QTLTPFEDLQ MSGNFESGIS MKGVKIEQDK SRLEWNMPCQ NQMEQIGFSS  360
SDPSIYWNAA TSTVGAWHDP PNIGSSITPL I*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012091630.10.0PREDICTED: dof zinc finger protein DOF1.4 isoform X1
TrEMBLA0A067JDZ70.0A0A067JDZ7_JATCU; Uncharacterized protein
STRINGPOPTR_0011s05450.11e-137(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF45223356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28310.19e-39Dof family protein